PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G15250.1
Common NameBBX9, COL11, dl3670c
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 330aa    MW: 36619.1 Da    PI: 4.9772
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G15250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.11.7e-08245340
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 e +C+ ++ +++ ++C++++  lC +C ++ H+       Ht++
  AT4G15250.1  2 EARCDFCGTEKALIYCKSDSAKLCLNCDVNVHSAnplsqrHTRS 45
                 579******99*********************667888888875 PP

2CCT60.74.7e-21276319144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a++RYk+K+++R F K+irY+sRKa+A++R+RvKGrFvk+ 
  AT4G15250.1 276 RDEAKKRYKQKKSKRMFGKQIRYASRKARADTRKRVKGRFVKSG 319
                  99***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.812147IPR000315B-box-type zinc finger
SMARTSM003362.3E-12147IPR000315B-box-type zinc finger
PfamPF006434.0E-7345IPR000315B-box-type zinc finger
CDDcd000211.45E-7447No hitNo description
PROSITE profilePS501198.7024388IPR000315B-box-type zinc finger
PfamPF062033.3E-16276318IPR010402CCT domain
PROSITE profilePS5101714.436276318IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEARCDFCGT EKALIYCKSD SAKLCLNCDV NVHSANPLSQ RHTRSLLCEK CSLQPTAVHC  60
MNENVSLCQG CQWTASNCTG LGHRLQSLNP YSDCPSPSDF GKIWSSTLEP SVTSLVSPFS  120
DTLLQELDDW NGSSTSVVTQ TQNLKDYSSF FPMESNLPKV IEEECSGLDL CEGINLDDAP  180
LNFNASNDII GCSSLDNTKC YEYEDSFKEE NNIGLPSLLL PTLSGNVVPN MSLSMSNLTG  240
ESNATDYQDC GISPGFLIGD SPWESNVEVS FNPKLRDEAK KRYKQKKSKR MFGKQIRYAS  300
RKARADTRKR VKGRFVKSGE TFEYDPSLVM
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865118260.0
Genevisible245542_at0.0
Expression AtlasAT4G15250-
AtGenExpressAT4G15250-
ATTED-IIAT4G15250-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G15250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G15250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615410.0AL161541.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 41.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973380.0Z97338.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193260.20.0putative zinc finger protein CONSTANS-LIKE 11
SwissprotO233790.0COL11_ARATH; Putative zinc finger protein CONSTANS-LIKE 11
TrEMBLD7MAK30.0D7MAK3_ARALL; Zinc finger (B-box type) family protein
STRINGAT4G15250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Representative plantOGRP13751334
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Becker JD,Boavida LC,Carneiro J,Haury M,Feij
    Transcriptional profiling of Arabidopsis tissues reveals the unique characteristics of the pollen transcriptome.
    Plant Physiol., 2003. 133(2): p. 713-25
    [PMID:14500793]
  5. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  6. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  7. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]